β-Amyloid (1-42), (rat/mouse) TFA
Number:PS38
Specifications:5mg
Price:Inquiry
Package:Box
Storage:F
- Description
- Related
- Technical
- Download
- Consulting/Order
Product Name:β-Amyloid (1-42), (rat/mouse) TFA
Number:PS38
Specifications:5mg
Basic Information
Purity:≥98%
Sequence Shortening:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence:Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Formula:C199H307N53O59S.xC2HF3O2
Molecular Weight:4418.02 (free acid)
Customized Services:All legally compliant peptide products are available for custom manufacturing. Customers provide specific peptide sequences , yield, purity, specifications, quantity, peptide modifications, and related experimental services.Product pricing may vary based on quantity, region, and specific requirements. We kindly request all customers to carefully confirm the details.
Disclaimer:This product is intended solely for laboratory research purposes and is not for clinical use. It must not be used as food, medicine, household items, or for any other non-research applications.The Company shall not be liable for any damages resulting from improper use or distribution of the product. Customers shall assume all risks associated with any research activities involving the product.
Instructions for Filling out the Form:
1. During working hours, we will reply by email or phone within one hour! During non-working hours, we will reply by email within 8 to 16 hours!
2. When placing an order for the product, you also need to fill in your company's invoicing information and the contact details for receiving the goods. We will reply with the latest discounted price and delivery time via email. After both parties reach an agreement through consultation, a product sales contract will be signed. The payment will be made to the company as agreed, and the invoice will be issued and the goods will be dispatched.